Lineage for d5i91a_ (5i91 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2424192Family b.82.1.6: Acireductone dioxygenase [82191] (2 proteins)
    automatically mapped to Pfam PF03079
  6. 2424193Protein Acireductone dioxygenase [82192] (2 species)
  7. 2424196Species Mouse (Mus musculus) [TaxId:10090] [141601] (6 PDB entries)
    Uniprot Q99JT9 1-179
  8. 2424199Domain d5i91a_: 5i91 A: [314926]
    automated match to d1vr3a1
    complexed with kmt, ni

Details for d5i91a_

PDB Entry: 5i91 (more details), 1.76 Å

PDB Description: structure of mouse acirecutone dioxygenase with to ni2+ and 2-keto-4- (methylthio)-butyric acid in the active site
PDB Compounds: (A:) 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase

SCOPe Domain Sequences for d5i91a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i91a_ b.82.1.6 (A:) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]}
mvqawymdestadprkphraqpdrpvsleqlrtlgvlywkldadkyendpelekirkmrn
yswmdiitickdtlpnyeekikmffeehlhldeeiryilegsgyfdvrdkedkwirisme
kgdmitlpagiyhrftldeknyvkamrlfvgepvwtpynrpadhfdarvqymsflegta

SCOPe Domain Coordinates for d5i91a_:

Click to download the PDB-style file with coordinates for d5i91a_.
(The format of our PDB-style files is described here.)

Timeline for d5i91a_: