Lineage for d5hj5c_ (5hj5 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922307Family c.124.1.1: NagB-like [52513] (3 proteins)
    share a common phosphate-binding site with the RpiA family
  6. 2922342Protein automated matches [191092] (2 species)
    not a true protein
  7. 2922346Species Vibrio cholerae [TaxId:243277] [260006] (2 PDB entries)
  8. 2922349Domain d5hj5c_: 5hj5 C: [314921]
    Other proteins in same PDB: d5hj5b2
    automated match to d4r7ta_
    complexed with acy, bg6, f6r, gol

Details for d5hj5c_

PDB Entry: 5hj5 (more details), 1.7 Å

PDB Description: crystal structure of tertiary complex of glucosamine-6-phosphate deaminase from vibrio cholerae with beta-d-glucose-6-phosphate and fructose-6-phosphate
PDB Compounds: (C:) glucosamine-6-phosphate deaminase

SCOPe Domain Sequences for d5hj5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hj5c_ c.124.1.1 (C:) automated matches {Vibrio cholerae [TaxId: 243277]}
mrliplkaaaqvgkwaaahivkrinefqptaerpfvlglptggtplatykaliemhkage
vsfkhvvtfnmdeyvglaadhpesyrsfmynnffnhidiqeeninllngntddheaeckr
yedkiksygkinlfmggvgndghiafnepasslssrtriktltedtriansrffdgdinq
vpkyaltigvgtlldaqeimilvtghnkalalqaavegsvnhlwtvsalqlhpkavivcd
epstqelkvktvkyfteleaknivgf

SCOPe Domain Coordinates for d5hj5c_:

Click to download the PDB-style file with coordinates for d5hj5c_.
(The format of our PDB-style files is described here.)

Timeline for d5hj5c_: