Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) |
Family c.124.1.1: NagB-like [52513] (3 proteins) share a common phosphate-binding site with the RpiA family |
Protein automated matches [191092] (2 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [260006] (2 PDB entries) |
Domain d5hj5c_: 5hj5 C: [314921] Other proteins in same PDB: d5hj5b2 automated match to d4r7ta_ complexed with acy, bg6, f6r, gol |
PDB Entry: 5hj5 (more details), 1.7 Å
SCOPe Domain Sequences for d5hj5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hj5c_ c.124.1.1 (C:) automated matches {Vibrio cholerae [TaxId: 243277]} mrliplkaaaqvgkwaaahivkrinefqptaerpfvlglptggtplatykaliemhkage vsfkhvvtfnmdeyvglaadhpesyrsfmynnffnhidiqeeninllngntddheaeckr yedkiksygkinlfmggvgndghiafnepasslssrtriktltedtriansrffdgdinq vpkyaltigvgtlldaqeimilvtghnkalalqaavegsvnhlwtvsalqlhpkavivcd epstqelkvktvkyfteleaknivgf
Timeline for d5hj5c_:
View in 3D Domains from other chains: (mouse over for more information) d5hj5a_, d5hj5b1, d5hj5b2, d5hj5d_ |