Lineage for d5i5ub_ (5i5u B:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins)
  6. Protein Branched-chain aminoacid aminotransferase [56757] (2 species)
  7. Species Human (Homo sapiens), mitochondrial [TaxId:9606] [64508] (26 PDB entries)
  8. Domain d5i5ub_: 5i5u B: [314920]
    automated match to d2hhfa_
    complexed with 67y, cl, edo, gol, plp

Details for d5i5ub_

PDB Entry: 5i5u (more details), 2.4 Å

PDB Description: x-ray crystal structure at 2.40a resolution of human mitochondrial branched chain aminotransferase (bcatm) complexed with a tetrahydronaphthalenyl compound and an internal aldimine linked plp cofactor.
PDB Compounds: (B:) Branched-chain-amino-acid aminotransferase, mitochondrial

SCOPe Domain Sequences for d5i5ub_:

Sequence, based on SEQRES records: (download)

>d5i5ub_ e.17.1.1 (B:) Branched-chain aminoacid aminotransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
ssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnltlh
passslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellecir
rlievdkdwvpdaagtslyvrpvlignepslgvsqptrallfvilcpvgayfpggsvtpv
slladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgtmn
ifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllralee
grvrevfgsgtacqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygirahewm
fpv

Sequence, based on observed residues (ATOM records): (download)

>d5i5ub_ e.17.1.1 (B:) Branched-chain aminoacid aminotransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
ssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnltlh
passslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellecir
rlievdkdwvpdaagtslyvrpvlignepslgvsqptrallfvilcpvgayfsvtpvsll
adpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgtmnifv
ywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllraleegrv
revfgsgtacqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygirahewmfpv

SCOPe Domain Coordinates for d5i5ub_ are not available.

Timeline for d5i5ub_:

Domains from other chains:
(mouse over for more information)
d5i5ua_