Lineage for d5hpla_ (5hpl A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548233Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily)
    consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation
  4. 2548234Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) (S)
    automatically mapped to Pfam PF00632
  5. 2548250Family d.148.1.0: automated matches [227207] (1 protein)
    not a true family
  6. 2548251Protein automated matches [226939] (2 species)
    not a true protein
  7. 2548252Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [314772] (1 PDB entry)
  8. 2548253Domain d5hpla_: 5hpl A: [314875]
    Other proteins in same PDB: d5hplc1, d5hplc2, d5hpld1, d5hpld2
    automated match to d2xbba_

Details for d5hpla_

PDB Entry: 5hpl (more details), 2.31 Å

PDB Description: system-wide modulation of hect e3 ligases with selective ubiquitin variant probes: rsp5 and ubv r5.4
PDB Compounds: (A:) Rsp5

SCOPe Domain Sequences for d5hpla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hpla_ d.148.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dfrrkviyfrsqpalrilpgqchikvrrknifedayqeimrqtpedlkkrlmikfdgeeg
ldyggvsrefffllshemfnpfyclfeysaydnytiqinpnsginpehlnyfkfigrvvg
lgvfhrrfldaffvgalykmmlrkkvvlqdmegvdaevynslnwmlensidgvldltfsa
dderfgevvtvdlkpdgrnievtdgnkkeyvelytqwrivdrvqeqfkafmdgfnelipe
dlvtvfderelelliggiaeidiedwkkhtdyrgyqesdeviqwfwkcvsewdneqrarl
lqfttgtsripvngfkdlqgsdgprrftiekagevqqlpkshtcfnrvdlpqyvdydsmk
qkltlaveet

SCOPe Domain Coordinates for d5hpla_:

Click to download the PDB-style file with coordinates for d5hpla_.
(The format of our PDB-style files is described here.)

Timeline for d5hpla_: