| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) ![]() contains a common phosphate-binding site |
| Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein) |
| Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species) |
| Species Escherichia coli [TaxId:562] [52338] (10 PDB entries) Uniprot P00968 |
| Domain d1cs0a2: 1cs0 A:936-1073 [31487] Other proteins in same PDB: d1cs0a1, d1cs0a3, d1cs0a4, d1cs0a5, d1cs0a6, d1cs0b1, d1cs0b2, d1cs0c1, d1cs0c3, d1cs0c4, d1cs0c5, d1cs0c6, d1cs0d1, d1cs0d2, d1cs0e1, d1cs0e3, d1cs0e4, d1cs0e5, d1cs0e6, d1cs0f1, d1cs0f2, d1cs0g1, d1cs0g3, d1cs0g4, d1cs0g5, d1cs0g6, d1cs0h1, d1cs0h2 complexed with adp, cl, k, mn, net, orn, po4 |
PDB Entry: 1cs0 (more details), 2 Å
SCOPe Domain Sequences for d1cs0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cs0a2 c.24.1.1 (A:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli [TaxId: 562]}
nstmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvh
egrphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamaln
adatekvisvqemhaqik
Timeline for d1cs0a2:
View in 3DDomains from other chains: (mouse over for more information) d1cs0b1, d1cs0b2, d1cs0c1, d1cs0c2, d1cs0c3, d1cs0c4, d1cs0c5, d1cs0c6, d1cs0d1, d1cs0d2, d1cs0e1, d1cs0e2, d1cs0e3, d1cs0e4, d1cs0e5, d1cs0e6, d1cs0f1, d1cs0f2, d1cs0g1, d1cs0g2, d1cs0g3, d1cs0g4, d1cs0g5, d1cs0g6, d1cs0h1, d1cs0h2 |