SCOPe 2.07: Domain d5hdbl2: 5hdb L:108-214

Lineage for d5hdbl2 (5hdb L:108-214)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d5hdbl2: 5hdb L:108-214 [314861]
   Other proteins in same PDB: d5hdba_, d5hdbc_, d5hdbf1, d5hdbl1
   automated match to d1tqbc2
   complexed with 5yb, bma, ca, cl, gol, man, mg, nag, so4

Details for d5hdbl2

PDB Entry: 5hdb, 2.7 Å

PDB Description: integrin alphaiibbeta3 in complex with ro-435054

PDB Compounds: (L:) monoclonal antibody 10e5 light chain

SCOPe Domain Sequences for d5hdbl2:

Sequence; same for both SEQRES and ATOM records:

>d5hdbl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d5hdbl2:

• d5hdbl2 first appeared in SCOPe 2.06
  
• d5hdbl2 appears in the current release, SCOPe 2.08