SCOPe 2.08: Domain d5hdbl2: 5hdb L:108-214

Lineage for d5hdbl2 (5hdb L:108-214)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
Domain d5hdbl2: 5hdb L:108-214 [314861]
Other proteins in same PDB: d5hdba_, d5hdbc_, d5hdbe_, d5hdbf1, d5hdbh_, d5hdbl1
automated match to d1tqbc2
complexed with 5yb, ca, cl, gol, mg, nag, so4

Details for d5hdbl2

PDB Entry: 5hdb (more details), 2.7 Å

PDB Description: integrin alphaiibbeta3 in complex with ro-435054

PDB Compounds: (L:) monoclonal antibody 10e5 light chain

SCOPe Domain Sequences for d5hdbl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hdbl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d5hdbl2:

Click to download the PDB-style file with coordinates for d5hdbl2.
(The format of our PDB-style files is described here.)

Timeline for d5hdbl2: