Lineage for d1c30g2 (1c30 G:936-1073)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22377Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
  4. 22378Superfamily c.24.1: Methylglyoxal synthase-like [52335] (2 families) (S)
  5. 22379Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein)
  6. 22380Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species)
  7. 22381Species Escherichia coli [TaxId:562] [52338] (7 PDB entries)
  8. 22389Domain d1c30g2: 1c30 G:936-1073 [31486]
    Other proteins in same PDB: d1c30a1, d1c30a3, d1c30a4, d1c30a5, d1c30a6, d1c30b1, d1c30b2, d1c30c1, d1c30c3, d1c30c4, d1c30c5, d1c30c6, d1c30d1, d1c30d2, d1c30e1, d1c30e3, d1c30e4, d1c30e5, d1c30e6, d1c30f1, d1c30f2, d1c30g1, d1c30g3, d1c30g4, d1c30g5, d1c30g6, d1c30h1, d1c30h2

Details for d1c30g2

PDB Entry: 1c30 (more details), 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s

SCOP Domain Sequences for d1c30g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c30g2 c.24.1.1 (G:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli}
nstmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvh
egrphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamaln
adatekvisvqemhaqik

SCOP Domain Coordinates for d1c30g2:

Click to download the PDB-style file with coordinates for d1c30g2.
(The format of our PDB-style files is described here.)

Timeline for d1c30g2: