SCOPe 2.08: Domain d5hmnd1: 5hmn D:1-152

Lineage for d5hmnd1 (5hmn D:1-152)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (49 species)
   not a true protein

7. Species Uncultured bacterium [TaxId:77133] [314792] (6 PDB entries)

8. Domain d5hmnd1: 5hmn D:1-152 [314856]
   Other proteins in same PDB: d5hmnb2, d5hmnd2
   automated match to d1bo4a_
   complexed with coa, pg4

Details for d5hmnd1

PDB Entry: 5hmn, 2.02 Å

PDB Description: crystal structure of an aminoglycoside acetyltransferase hmb0005 from an uncultured soil metagenomic sample, unknown active site density modeled as polyethylene glycol

PDB Compounds: (D:) aac3-I

SCOPe Domain Sequences for d5hmnd1:

Sequence; same for both SEQRES and ATOM records:

>d5hmnd1 d.108.1.0 (D:1-152) automated matches {Uncultured bacterium [TaxId: 77133]}
msldvhqlspnevalmetllatfgeafndmetytgnrprgaysrrllesdyfialaaley
geivgglaayelkkfeqerseiyiydlavakahrrrgiatalieklkelgaargayvifv
qadtaiedepaialysklgvreevlhfdipvs

Timeline for d5hmnd1:

• d5hmnd1 first appeared in SCOPe 2.06
  
• d5hmnd1 appears in SCOPe 2.07