Lineage for d5hvva_ (5hvv A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. Family d.80.1.3: MIF-related [55339] (3 proteins)
    automatically mapped to Pfam PF01187
  6. Protein Microphage migration inhibition factor (MIF) [55340] (7 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. Species Human (Homo sapiens) [TaxId:9606] [55341] (94 PDB entries)
  8. Domain d5hvva_: 5hvv A: [314850]
    automated match to d4xx7a_
    complexed with ipa, so4; mutant

Details for d5hvva_

PDB Entry: 5hvv (more details), 1.9 Å

PDB Description: crystal structure of pro1 deletion and m2a double mutant of macrophage migration inhibitory factor
PDB Compounds: (A:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d5hvva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hvva_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
afivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcsl
hsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

SCOPe Domain Coordinates for d5hvva_ are not available.

Timeline for d5hvva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5hvvb_, d5hvvc_