![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
![]() | Family b.22.1.0: automated matches [191519] (1 protein) not a true family |
![]() | Protein automated matches [190873] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries) |
![]() | Domain d5hzfa3: 5hzf A:276-407 [314842] automated match to d2wnvb_ complexed with mg |
PDB Entry: 5hzf (more details), 1.55 Å
SCOPe Domain Sequences for d5hzfa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hzfa3 b.22.1.0 (A:276-407) automated matches {Human (Homo sapiens) [TaxId: 9606]} tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega nsifsgfllfpd
Timeline for d5hzfa3: