Lineage for d5hzfa2 (5hzf A:140-275)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777598Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2777599Protein automated matches [190873] (4 species)
    not a true protein
  7. 2777600Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries)
  8. 2777610Domain d5hzfa2: 5hzf A:140-275 [314841]
    automated match to d2wnvb_
    complexed with mg

Details for d5hzfa2

PDB Entry: 5hzf (more details), 1.55 Å

PDB Description: single chain recombinant globular head of the complement system protein c1q in complex with magnesium
PDB Compounds: (A:) Complement C1q subcomponent subunit A,Complement C1q subcomponent subunit C,Complement C1q subcomponent subunit B

SCOPe Domain Sequences for d5hzfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hzfa2 b.22.1.0 (A:140-275) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqkfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhash
tanlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsd
svfsgfllfpdgsaka

SCOPe Domain Coordinates for d5hzfa2:

Click to download the PDB-style file with coordinates for d5hzfa2.
(The format of our PDB-style files is described here.)

Timeline for d5hzfa2: