![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88590] (69 PDB entries) Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region |
![]() | Domain d5hsfb_: 5hsf B: [314837] automated match to d1pfca_ complexed with pge |
PDB Entry: 5hsf (more details), 1.52 Å
SCOPe Domain Sequences for d5hsfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hsfb_ b.1.1.2 (B:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} kakgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppv ldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslsp
Timeline for d5hsfb_: