Lineage for d5hwja1 (5hwj A:1-303)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2098336Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2098337Protein automated matches [190115] (75 species)
    not a true protein
  7. 2098362Species Agrobacterium fabrum [TaxId:176299] [314806] (3 PDB entries)
  8. 2098367Domain d5hwja1: 5hwj A:1-303 [314833]
    Other proteins in same PDB: d5hwja2, d5hwjd2
    automated match to d4ur7a_
    complexed with fmt, gol

Details for d5hwja1

PDB Entry: 5hwj (more details), 1.65 Å

PDB Description: crystal structure of keto-deoxy-d-galactarate dehydratase
PDB Compounds: (A:) Probable 5-dehydro-4-deoxyglucarate dehydratase

SCOPe Domain Sequences for d5hwja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hwja1 c.1.10.0 (A:1-303) automated matches {Agrobacterium fabrum [TaxId: 176299]}
mdpeqiktalgsgllsfpvthfdaegrfaadsyrehvewlagykapvlfaaggtgeffsl
kpdeiptivaaakevagetaivsgcgygteiavdiarsvekvgadgilllphylidapqe
glyahikkvcqsvgigvmvynrdnsvlqadtlarlcdecpnlvgfkdgtgdiglvrqita
kmgdrlmylggmptaelfaeaylgagfttyssavfnfvpglanefyaalrageratceri
lvdffypfmairnrakgyavsavkagvrlqgfnagpvraplkdltneeigmlealigthk
rka

SCOPe Domain Coordinates for d5hwja1:

Click to download the PDB-style file with coordinates for d5hwja1.
(The format of our PDB-style files is described here.)

Timeline for d5hwja1: