Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (48 species) not a true protein |
Species Uncultured bacterium [TaxId:77133] [314792] (6 PDB entries) |
Domain d5hmne_: 5hmn E: [314830] Other proteins in same PDB: d5hmnb2, d5hmnd2 automated match to d1bo4a_ complexed with coa, pg4 |
PDB Entry: 5hmn (more details), 2.02 Å
SCOPe Domain Sequences for d5hmne_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hmne_ d.108.1.0 (E:) automated matches {Uncultured bacterium [TaxId: 77133]} sldvhqlspnevalmetllatfgeafndmetytgnrprgaysrrllesdyfialaaleyg eivgglaayelkkfeqerseiyiydlavakahrrrgiatalieklkelgaargayvifvq adtaiedepaialysklgvreevlhfdipvs
Timeline for d5hmne_: