| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
| Protein automated matches [190115] (94 species) not a true protein |
| Species Agrobacterium fabrum [TaxId:176299] [314806] (3 PDB entries) |
| Domain d5hwjd1: 5hwj D:1-303 [314829] Other proteins in same PDB: d5hwja2, d5hwjd2 automated match to d4ur7a_ complexed with fmt, gol |
PDB Entry: 5hwj (more details), 1.65 Å
SCOPe Domain Sequences for d5hwjd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hwjd1 c.1.10.0 (D:1-303) automated matches {Agrobacterium fabrum [TaxId: 176299]}
mdpeqiktalgsgllsfpvthfdaegrfaadsyrehvewlagykapvlfaaggtgeffsl
kpdeiptivaaakevagetaivsgcgygteiavdiarsvekvgadgilllphylidapqe
glyahikkvcqsvgigvmvynrdnsvlqadtlarlcdecpnlvgfkdgtgdiglvrqita
kmgdrlmylggmptaelfaeaylgagfttyssavfnfvpglanefyaalrageratceri
lvdffypfmairnrakgyavsavkagvrlqgfnagpvraplkdltneeigmlealigthk
rka
Timeline for d5hwjd1:
View in 3DDomains from other chains: (mouse over for more information) d5hwja1, d5hwja2, d5hwjb_, d5hwjc_ |