Lineage for d1a9xg2 (1a9x G:6936-7073)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 482161Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 482162Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) (S)
    contains a common phosphate-binding site
  5. 482163Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein)
  6. 482164Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species)
  7. 482165Species Escherichia coli [TaxId:562] [52338] (10 PDB entries)
  8. 482169Domain d1a9xg2: 1a9x G:6936-7073 [31482]
    Other proteins in same PDB: d1a9xa1, d1a9xa3, d1a9xa4, d1a9xa5, d1a9xa6, d1a9xb1, d1a9xb2, d1a9xc1, d1a9xc3, d1a9xc4, d1a9xc5, d1a9xc6, d1a9xd1, d1a9xd2, d1a9xe1, d1a9xe3, d1a9xe4, d1a9xe5, d1a9xe6, d1a9xf1, d1a9xf2, d1a9xg1, d1a9xg3, d1a9xg4, d1a9xg5, d1a9xg6, d1a9xh1, d1a9xh2

Details for d1a9xg2

PDB Entry: 1a9x (more details), 1.8 Å

PDB Description: carbamoyl phosphate synthetase: caught in the act of glutamine hydrolysis

SCOP Domain Sequences for d1a9xg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9xg2 c.24.1.1 (G:6936-7073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli}
nstmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvh
egrphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamaln
adatekvisvqemhaqik

SCOP Domain Coordinates for d1a9xg2:

Click to download the PDB-style file with coordinates for d1a9xg2.
(The format of our PDB-style files is described here.)

Timeline for d1a9xg2: