Lineage for d5hw2a1 (5hw2 A:1-432)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337216Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2337217Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2337388Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2337389Protein automated matches [190621] (25 species)
    not a true protein
  7. 2337419Species Francisella tularensis [TaxId:177416] [195577] (2 PDB entries)
  8. 2337422Domain d5hw2a1: 5hw2 A:1-432 [314819]
    Other proteins in same PDB: d5hw2a2, d5hw2b2
    automated match to d2x75a_
    complexed with edo, fum, k, po4

Details for d5hw2a1

PDB Entry: 5hw2 (more details), 2.05 Å

PDB Description: crystal structure of adenylosuccinate lyase from francisella tularensis complexed with fumaric acid
PDB Compounds: (A:) adenylosuccinate lyase

SCOPe Domain Sequences for d5hw2a1:

Sequence, based on SEQRES records: (download)

>d5hw2a1 a.127.1.0 (A:1-432) automated matches {Francisella tularensis [TaxId: 177416]}
mikrydvaeiskiwadenkyakmlevelailealedrmvpkgtaaeiraraqirpervde
iekvtkhdiiafctsiaeqftaetgkffhfgvtssdiidsalslqirdsmsyvikdleal
cdslltkaeetkeiitmgrshgmfaepmsfgqkflgayvefkrrlkdlkdfqkdgltvqf
sgavgnycilttedekkaadilglpveevstqviprdriaklisihgliasaierlavei
rhlhrsdvfevyegfskgqkgsstmphkknpistenltgmarmlrshvsialencvlwhe
rdishssaerfylpdnfgimvyalrrmkntidnlvvqrdiiedrvrstsaylssfylhfl
vantpfmredcykivqqvafdlkqgesfskklqkvmhdehniildipemdfegikktylk
eidhvfdrsvka

Sequence, based on observed residues (ATOM records): (download)

>d5hw2a1 a.127.1.0 (A:1-432) automated matches {Francisella tularensis [TaxId: 177416]}
mikrydvaeiskiwadenkyakmlevelailealedrmvpkgtaaeiraraqirpervde
iekvtkhdiiafctsiaeqftaetgkffhfgvtssdiidsalslqirdsmsyvikdleal
cdslltkaeetkeiitmgrshgmfaepmsfgqkflgayvefkrrlkdlkdfqkdgltvqf
sgavgnycilttedekkaadilglpveevstqviprdriaklisihgliasaierlavei
rhlhrsdvfevyegfkknpistenltgmarmlrshvsialencvlwherdishssaerfy
lpdnfgimvyalrrmkntidnlvvqrdiiedrvrstsaylssfylhflvantpfmredcy
kivqqvesfskklqkvmhdehniildipemdfegikktylkeidhvfdrsvka

SCOPe Domain Coordinates for d5hw2a1:

Click to download the PDB-style file with coordinates for d5hw2a1.
(The format of our PDB-style files is described here.)

Timeline for d5hw2a1: