SCOPe 2.07: Domain d5hd4a_: 5hd4 A:

Lineage for d5hd4a_ (5hd4 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein MAP kinase Erk2 [56134] (2 species)
   CMGC group; ERK/MAPK subfamily; serine/threonine kinase

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [56136] (57 PDB entries)

8. Domain d5hd4a_: 5hd4 A: [314815]
   automated match to d2erka_
   complexed with 38z, dms, pg4, so4

Details for d5hd4a_

PDB Entry: 5hd4, 1.45 Å

PDB Description: dissecting therapeutic resistance to erk inhibition rat wild type sch772984 in complex with (3r)-1-(2-oxo-2-{4-[4-(pyrimidin-2-yl) phenyl]piperazin-1-yl}ethyl)-n-[3-(pyridin-4-yl)-2h-indazol-5- yl]pyrrolidine-3-carboxamide

PDB Compounds: (A:) Mitogen-activated protein kinase 1

SCOPe Domain Sequences for d5hd4a_:

Sequence; same for both SEQRES and ATOM records:

>d5hd4a_ d.144.1.7 (A:) MAP kinase Erk2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtlr
eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl
yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvat
rwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqe
dlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalah
pyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpg

Timeline for d5hd4a_:

• d5hd4a_ first appeared in SCOPe 2.06
  
• d5hd4a_ appears in the current release, SCOPe 2.08