Lineage for d5hd4a_ (5hd4 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981976Protein MAP kinase Erk2 [56134] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2982066Species Norway rat (Rattus norvegicus) [TaxId:10116] [56136] (58 PDB entries)
  8. 2982072Domain d5hd4a_: 5hd4 A: [314815]
    automated match to d2erka_
    complexed with 38z, dms, pg4, so4

Details for d5hd4a_

PDB Entry: 5hd4 (more details), 1.45 Å

PDB Description: dissecting therapeutic resistance to erk inhibition rat wild type sch772984 in complex with (3r)-1-(2-oxo-2-{4-[4-(pyrimidin-2-yl) phenyl]piperazin-1-yl}ethyl)-n-[3-(pyridin-4-yl)-2h-indazol-5- yl]pyrrolidine-3-carboxamide
PDB Compounds: (A:) Mitogen-activated protein kinase 1

SCOPe Domain Sequences for d5hd4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hd4a_ d.144.1.7 (A:) MAP kinase Erk2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtlr
eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl
yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvat
rwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqe
dlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalah
pyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpg

SCOPe Domain Coordinates for d5hd4a_:

Click to download the PDB-style file with coordinates for d5hd4a_.
(The format of our PDB-style files is described here.)

Timeline for d5hd4a_: