Lineage for d5hs3f1 (5hs3 F:26-305)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2578767Protein Thymidylate synthase [55833] (7 species)
  7. 2578916Species Human (Homo sapiens) [TaxId:9606] [55840] (42 PDB entries)
  8. 2579044Domain d5hs3f1: 5hs3 F:26-305 [314802]
    Other proteins in same PDB: d5hs3a2, d5hs3b2, d5hs3c2, d5hs3d2, d5hs3e2, d5hs3f2
    automated match to d1hvya_
    complexed with ki3, ump

Details for d5hs3f1

PDB Entry: 5hs3 (more details), 3.1 Å

PDB Description: human thymidylate synthase complexed with dump and 3-amino-2-benzoyl- 4-methylthieno[2,3-b]pyridin-6-ol
PDB Compounds: (F:) Thymidylate synthase

SCOPe Domain Sequences for d5hs3f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hs3f1 d.117.1.1 (F:26-305) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphp

SCOPe Domain Coordinates for d5hs3f1:

Click to download the PDB-style file with coordinates for d5hs3f1.
(The format of our PDB-style files is described here.)

Timeline for d5hs3f1: