Lineage for d5hoza3 (5hoz A:388-583)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013466Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2013467Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2013840Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2013841Protein automated matches [254493] (6 species)
    not a true protein
  7. 2013886Species Horse (Equus caballus) [TaxId:9796] [256129] (14 PDB entries)
  8. 2013907Domain d5hoza3: 5hoz A:388-583 [314797]
    automated match to d1hk2a3

Details for d5hoza3

PDB Entry: 5hoz (more details), 2.15 Å

PDB Description: crystal structure of equine serum albumin (esa) at ph 9.0
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d5hoza3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hoza3 a.126.1.0 (A:388-583) automated matches {Horse (Equus caballus) [TaxId: 9796]}
kkncdlfeevgeydfqnalivrytkkapqvstptlveigrtlgkvgsrccklpeserlpc
senhlalalnrlcvlhektpvsekitkcctdslaerrpcfsaleldegyvpkefkaetft
fhadictlpedekqikkqsalaelvkhkpkatkeqlktvlgnfsafvakccgaedkeacf
aeegpklvassqlala

SCOPe Domain Coordinates for d5hoza3:

Click to download the PDB-style file with coordinates for d5hoza3.
(The format of our PDB-style files is described here.)

Timeline for d5hoza3: