Lineage for d5hmnf_ (5hmn F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969510Species Uncultured bacterium [TaxId:77133] [314792] (6 PDB entries)
  8. 2969526Domain d5hmnf_: 5hmn F: [314793]
    Other proteins in same PDB: d5hmnb2, d5hmnd2
    automated match to d1bo4a_
    complexed with coa, pg4

Details for d5hmnf_

PDB Entry: 5hmn (more details), 2.02 Å

PDB Description: crystal structure of an aminoglycoside acetyltransferase hmb0005 from an uncultured soil metagenomic sample, unknown active site density modeled as polyethylene glycol
PDB Compounds: (F:) aac3-I

SCOPe Domain Sequences for d5hmnf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hmnf_ d.108.1.0 (F:) automated matches {Uncultured bacterium [TaxId: 77133]}
sldvhqlspnevalmetllatfgeafndmetytgnrprgaysrrllesdyfialaaleyg
eivgglaayelkkfeqerseiyiydlavakahrrrgiatalieklkelgaargayvifvq
adtaiedepaialysklgvreevlhfdipvs

SCOPe Domain Coordinates for d5hmnf_:

Click to download the PDB-style file with coordinates for d5hmnf_.
(The format of our PDB-style files is described here.)

Timeline for d5hmnf_: