SCOPe 2.06: Domain d5ht0f_: 5ht0 F:

Lineage for d5ht0f_ (5ht0 F:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest

4. Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families)

5. Family c.140.1.0: automated matches [191555] (1 protein)
   not a true family

6. Protein automated matches [190957] (4 species)
   not a true protein

7. Species Uncultured bacterium [TaxId:77133] [314779] (1 PDB entry)

8. Domain d5ht0f_: 5ht0 F: [314790]
   automated match to d3e4fa_
   complexed with coa, so4

Details for d5ht0f_

PDB Entry: 5ht0, 2.75 Å

PDB Description: crystal structure of an antibiotic_nat family aminoglycoside acetyltransferase hmb0038 from an uncultured soil metagenomic sample in complex with coenzyme a

PDB Compounds: (F:) Aminoglycoside acetyltransferase HMB0005

SCOPe Domain Sequences for d5ht0f_:

Sequence; same for both SEQRES and ATOM records:

>d5ht0f_ c.140.1.0 (F:) automated matches {Uncultured bacterium [TaxId: 77133]}
rvstrsslaedlraigladgdavlvhaalrkvgkivggpddildamrdvigpagtvlgya
dwqledeirddpamrehipafdplrsrsirdngfwpelirttpgalrsaspgasmaaigg
eaewftadhaldygygprsplgklveakgkvlmlgapldtmtllhhaehladfpnkrilr
yeapilvdgekvwrwfeefdtsdppdgladdyfagiveeflatgrgkrgkigeassvlvp
adeivafavdwlerwgrta

Timeline for d5ht0f_:

• d5ht0f_ is new in SCOPe 2.06-stable
  
• d5ht0f_ appears in SCOPe 2.07
  
• d5ht0f_ appears in the current release, SCOPe 2.08