SCOPe 2.07: Domain d5hg1a3: 5hg1 A:466-670

Lineage for d5hg1a3 (5hg1 A:466-670)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (63 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (68 PDB entries)

8. Domain d5hg1a3: 5hg1 A:466-670 [314788]
   automated match to d2nzta3
   complexed with 62c, bg6, flc

Details for d5hg1a3

PDB Entry: 5hg1, 2.76 Å

PDB Description: crystal structure of human hexokinase 2 with cmpd 1, a c-2-substituted glucosamine

PDB Compounds: (A:) Hexokinase-2

SCOPe Domain Sequences for d5hg1a3:

Sequence, based on SEQRES records:

>d5hg1a3 c.55.1.0 (A:466-670) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qhrarqktlehlqlshdqllevkrrmkvemerglskethasapvkmlptyvcatpdgtek
gdflaldlggtnfrvllvrvrngkwggvemhnkiyaipqevmhgtgdelfdhivqciadf
leymgmkgvslplgftfsfpcqqnsldesillkwtkgfkasgcegedvvtllkeaihrre
efdldvvavvndtvgtmmtcgfedp

Sequence, based on observed residues (ATOM records):

>d5hg1a3 c.55.1.0 (A:466-670) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qhrarqktlehlqlshdqllevkrrmkvemerglskethasapvkmlptyvcatpdgtek
gdflaldlggtnfrvllvrvrnggvemhnkiyaipqevmhgtgdelfdhivqciadfley
mgmkgvslplgftfsfpcqqnsldesillkwtkgfkasgcegedvvtllkeaihrreefd
ldvvavvndtvgtmmtcgfedp

Timeline for d5hg1a3:

• d5hg1a3 first appeared in SCOPe 2.06
  
• d5hg1a3 appears in the current release, SCOPe 2.08