SCOPe 2.08: Domain d1fy2a_: 1fy2 A:

Lineage for d1fy2a_ (1fy2 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.4: Aspartyl dipeptidase PepE [52331] (2 proteins)
   probable circular permutation in the common core; contains a catalytic Ser-His-Glu triad

6. Protein Aspartyl dipeptidase PepE [52332] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [52333] (2 PDB entries)

8. Domain d1fy2a_: 1fy2 A: [31478]
   complexed with cd

Details for d1fy2a_

PDB Entry: 1fy2, 1.2 Å

PDB Description: Aspartyl Dipeptidase

PDB Compounds: (A:) aspartyl dipeptidase

SCOPe Domain Sequences for d1fy2a_:

Sequence, based on SEQRES records:

>d1fy2a_ c.23.16.4 (A:) Aspartyl dipeptidase PepE {Salmonella typhimurium [TaxId: 90371]}
mellllsnstlpgkawlehalplianqlngrrsavfipfagvtqtwdeytdktaevlapl
gvnvtgihrvadplaaiekaeiiivgggntfqllkesrergllapmadrvkrgalyigws
aganlacptirttndmpivdpngfdaldlfplqinphftnalpeghkgetreqrirellv
vapeltviglpegnwiqvsngqavlggpnttwvfkageeavaleaghrf

Sequence, based on observed residues (ATOM records):

>d1fy2a_ c.23.16.4 (A:) Aspartyl dipeptidase PepE {Salmonella typhimurium [TaxId: 90371]}
mellllsnstlpgkawlehalplianqlngrrsavfipfagvtqtwdeytdktaevlapl
gvnvtgihrvadplaaiekaeiiivgggntfqllkesrergllapmadrvkrgalyigws
aganlacptirttndmpivdpngfdaldlfplqinphftntreqrirellvvapeltvig
lpegnwiqvsngqavlggpnttwvfkageeavaleaghrf

Timeline for d1fy2a_:

• d1fy2a_ first appeared (with stable ids) in SCOP 1.55
  
• d1fy2a_ appears in SCOPe 2.07