Lineage for d5hpte_ (5hpt E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933161Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)
  8. 2933363Domain d5hpte_: 5hpt E: [314770]
    Other proteins in same PDB: d5hpta_, d5hptc_, d5hptd_, d5hptf_, d5hptg_
    automated match to d3b1lx_

Details for d5hpte_

PDB Entry: 5hpt (more details), 2.84 Å

PDB Description: system-wide modulation of hect e3 ligases with selective ubiquitin variant probes: wwp1, ubv p2.3 and ubch7
PDB Compounds: (E:) Ubiquitin variant P2.3

SCOPe Domain Sequences for d5hpte_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hpte_ d.15.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqilvktftwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
ikmgsslylvlrlpgq

SCOPe Domain Coordinates for d5hpte_:

Click to download the PDB-style file with coordinates for d5hpte_.
(The format of our PDB-style files is described here.)

Timeline for d5hpte_: