Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.4: Aspartyl dipeptidase PepE [52331] (2 proteins) probable circular permutation in the common core; contains a catalytic Ser-His-Glu triad |
Protein Aspartyl dipeptidase PepE [52332] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [52333] (2 PDB entries) |
Domain d1fyea_: 1fye A: [31477] complexed with cd |
PDB Entry: 1fye (more details), 1.2 Å
SCOPe Domain Sequences for d1fyea_:
Sequence, based on SEQRES records: (download)
>d1fyea_ c.23.16.4 (A:) Aspartyl dipeptidase PepE {Salmonella typhimurium [TaxId: 90371]} mellllsnstlpgkawlehalplianqlngrrsavfipfagvtqtwdeytdktaevlapl gvnvtgihrvadplaaiekaeiiivgggntfqllkesrergllapmadrvkrgalyigws aganlacptirttndmpivdpngfdaldlfplqinphftnalpeghkgetreqrirellv vapeltviglpegnwiqvsngqavlggpnttwvfkageeavaleaghrf
>d1fyea_ c.23.16.4 (A:) Aspartyl dipeptidase PepE {Salmonella typhimurium [TaxId: 90371]} mellllsnstlpgkawlehalplianqlngrrsavfipfagvtqtwdeytdktaevlapl gvnvtgihrvadplaaiekaeiiivgggntfqllkesrergllapmadrvkrgalyigws aganlacptirttndmpivdpngfdaldlfplqinphftntreqrirellvvapeltvig lpegnwiqvsngqavlggpnttwvfkageeavaleaghrf
Timeline for d1fyea_: