Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (140 species) not a true protein |
Species Pelagibacter ubique [TaxId:335992] [314766] (3 PDB entries) |
Domain d5hmta1: 5hmt A:13-248 [314767] Other proteins in same PDB: d5hmta2 automated match to d3kbra_ |
PDB Entry: 5hmt (more details), 1.57 Å
SCOPe Domain Sequences for d5hmta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hmta1 c.94.1.0 (A:13-248) automated matches {Pelagibacter ubique [TaxId: 335992]} eskldqilssgelkvgttgdwdpmamkdpatnkykgfdidvmqelakdmgvkitfvptew ktivsgitagrydistsvtktpkraevagftdsyykygtvplvlkknlkkystwkslnnk dvtiattlgtsqeekakeffplsklqsvespardfqevlagradgnitssteanklvvky pqlaivpdgeknpaflammvskndqvwndyvnewikskkssgffnkllakynlksl
Timeline for d5hmta1: