SCOPe 2.06: Domain d5hmta1: 5hmt A:13-248

Lineage for d5hmta1 (5hmt A:13-248)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Pelagibacter ubique [TaxId:335992] [314766] (3 PDB entries)

8. Domain d5hmta1: 5hmt A:13-248 [314767]
   Other proteins in same PDB: d5hmta2
   automated match to d3kbra_

Details for d5hmta1

PDB Entry: 5hmt, 1.57 Å

PDB Description: crystal structure of the cyclohexadienyl dehydratase-like solute- binding protein sar11_1068 from candidatus pelagibacter ubique.

PDB Compounds: (A:) Cyclohexadienyl dehydratase

SCOPe Domain Sequences for d5hmta1:

Sequence; same for both SEQRES and ATOM records:

>d5hmta1 c.94.1.0 (A:13-248) automated matches {Pelagibacter ubique [TaxId: 335992]}
eskldqilssgelkvgttgdwdpmamkdpatnkykgfdidvmqelakdmgvkitfvptew
ktivsgitagrydistsvtktpkraevagftdsyykygtvplvlkknlkkystwkslnnk
dvtiattlgtsqeekakeffplsklqsvespardfqevlagradgnitssteanklvvky
pqlaivpdgeknpaflammvskndqvwndyvnewikskkssgffnkllakynlksl

Timeline for d5hmta1:

• d5hmta1 is new in SCOPe 2.06-stable
  
• d5hmta1 does not appear in SCOPe 2.07