SCOPe 2.08: Domain d5hmsb_: 5hms B:

Lineage for d5hmsb_ (5hms B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins)
   hybrid of classes I and II aldolase
   automatically mapped to Pfam PF00490

6. Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63921] (4 PDB entries)

8. Domain d5hmsb_: 5hms B: [314758]
   automated match to d1e51a_
   complexed with zn

Details for d5hmsb_

PDB Entry: 5hms, 2.8 Å

PDB Description: x-ray structure of human recombinant 5-aminolaevulinic acid dehydratase (hralad).

PDB Compounds: (B:) delta-aminolevulinic acid dehydratase

SCOPe Domain Sequences for d5hmsb_:

Sequence; same for both SEQRES and ATOM records:

>d5hmsb_ c.1.10.3 (B:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens) [TaxId: 9606]}
mqpqsvlhsgyfhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkr
leemlrplveeglrcvlifgvpsrvpkdergsaadseespaieaihllrktfpnllvacd
vclcpytshghcgllsengafraeesrqrlaevalayakagcqvvapsdmmdgrveaike
almahglgnrvsvmsysakfascfygpfrdaaksspafgdrrcyqlppgarglalravdr
dvregadmlmvkpgmpyldivrevkdkhpdlplavyhvsgefamlwhgaqagafdlkaav
leamtafrragadiiityytpqllqwlk

Timeline for d5hmsb_:

• d5hmsb_ first appeared in SCOPe 2.06
  
• d5hmsb_ appears in SCOPe 2.07