SCOPe 2.08: Domain d5hmhb1: 5hmh B:21-116

Lineage for d5hmhb1 (5hmh B:21-116)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
   Pfam PF02201

6. Protein MDM2 [47594] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47596] (76 PDB entries)

8. Domain d5hmhb1: 5hmh B:21-116 [314747]
   Other proteins in same PDB: d5hmha2, d5hmhb2
   automated match to d1ttva_
   complexed with 62r, so4

Details for d5hmhb1

PDB Entry: 5hmh, 1.79 Å

PDB Description: hdm2 in complex with a 3,3-disubstituted piperidine

PDB Compounds: (B:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d5hmhb1:

Sequence; same for both SEQRES and ATOM records:

>d5hmhb1 a.42.1.1 (B:21-116) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
aseqetlvrpkplllkllksvgaqkdtytmkevlyylgqyimtkrlydekqqhivhcsnd
llgdlfgvpsfsvkehrkiytmiyrnlvvvnqqess

Timeline for d5hmhb1:

• d5hmhb1 first appeared in SCOPe 2.06
  
• d5hmhb1 appears in SCOPe 2.07