Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) |
Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins) |
Protein automated matches [190153] (5 species) not a true protein |
Species Bacillus megaterium [TaxId:1404] [314651] (1 PDB entry) |
Domain d5heih1: 5hei H:1-245 [314746] Other proteins in same PDB: d5heia2, d5heib2, d5heic2, d5heid2, d5heie2, d5heif2, d5heig2, d5heih2 automated match to d1zcha1 complexed with fmn, mpd, so4 |
PDB Entry: 5hei (more details), 2.84 Å
SCOPe Domain Sequences for d5heih1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5heih1 d.90.1.1 (H:1-245) automated matches {Bacillus megaterium [TaxId: 1404]} mneairtiqdhrsirqytdeavsdehldtiiqsaqsaassingqqvtiisvqdkekkkkl selagnqawidqaplflifcadfnrakiaaelndaplgvtdglesilvgatdagisleaa tvaaeslglgtvpiggirrkplevielldlpeyvfpvsglvvghpsdhsakkprlpqaav hhresynhdlksliqdydaemaeymkkrtngaddrnwsqtvsaiyktiyypevramlekq gfkfe
Timeline for d5heih1: