SCOPe 2.08: Domain d5heih1: 5hei H:1-245

Lineage for d5heih1 (5hei H:1-245)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
   core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243

4. Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families)

5. Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)

6. Protein automated matches [190153] (5 species)
   not a true protein

7. Species Bacillus megaterium [TaxId:1404] [314651] (1 PDB entry)

8. Domain d5heih1: 5hei H:1-245 [314746]
   Other proteins in same PDB: d5heia2, d5heib2, d5heic2, d5heid2, d5heie2, d5heif2, d5heig2, d5heih2
   automated match to d1zcha1
   complexed with fmn, mpd, so4

Details for d5heih1

PDB Entry: 5hei, 2.84 Å

PDB Description: structure of b. megaterium nfra2

PDB Compounds: (H:) NfrA2

SCOPe Domain Sequences for d5heih1:

Sequence; same for both SEQRES and ATOM records:

>d5heih1 d.90.1.1 (H:1-245) automated matches {Bacillus megaterium [TaxId: 1404]}
mneairtiqdhrsirqytdeavsdehldtiiqsaqsaassingqqvtiisvqdkekkkkl
selagnqawidqaplflifcadfnrakiaaelndaplgvtdglesilvgatdagisleaa
tvaaeslglgtvpiggirrkplevielldlpeyvfpvsglvvghpsdhsakkprlpqaav
hhresynhdlksliqdydaemaeymkkrtngaddrnwsqtvsaiyktiyypevramlekq
gfkfe

Timeline for d5heih1:

• d5heih1 first appeared in SCOPe 2.06
  
• d5heih1 appears in SCOPe 2.07