Lineage for d5h89c_ (5h89 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940226Protein automated matches [190406] (19 species)
    not a true protein
  7. 2940296Species Coral (Discosoma sp.) [TaxId:86600] [188539] (22 PDB entries)
  8. 2940343Domain d5h89c_: 5h89 C: [314745]
    automated match to d3st2a_
    mutant

Details for d5h89c_

PDB Entry: 5h89 (more details), 1.76 Å

PDB Description: crystal structure of mrojoa mutant - t16v - p63y - w143g - l163v
PDB Compounds: (C:) mRojoA fluorescent protein

SCOPe Domain Sequences for d5h89c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h89c_ d.22.1.1 (C:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
maiikefmrfkvhmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilsyq
fmygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvkl
hgtnfpsdgpvmqkktmggeassermypedgalkgeikvrlklkdgghydaevkttykak
kpvqlpgaynanyklditshnedytiveqyercegrhs

SCOPe Domain Coordinates for d5h89c_:

Click to download the PDB-style file with coordinates for d5h89c_.
(The format of our PDB-style files is described here.)

Timeline for d5h89c_: