Lineage for d1iphb1 (1iph B:598-753)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2859120Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein)
  6. 2859121Protein Catalase, C-terminal domain [52329] (2 species)
  7. 2859122Species Escherichia coli, HPII [TaxId:562] [52330] (17 PDB entries)
  8. 2859176Domain d1iphb1: 1iph B:598-753 [31474]
    Other proteins in same PDB: d1ipha2, d1iphb2, d1iphc2, d1iphd2
    complexed with hem

Details for d1iphb1

PDB Entry: 1iph (more details), 2.8 Å

PDB Description: structure of catalase hpii from escherichia coli
PDB Compounds: (B:) catalase hpii

SCOPe Domain Sequences for d1iphb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iphb1 c.23.16.3 (B:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

SCOPe Domain Coordinates for d1iphb1:

Click to download the PDB-style file with coordinates for d1iphb1.
(The format of our PDB-style files is described here.)

Timeline for d1iphb1: