SCOPe 2.06: Domain d5hi6b1: 5hi6 B:1-160

Lineage for d5hi6b1 (5hi6 B:1-160)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein automated matches [190514] (11 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [314715] (1 PDB entry)

8. Domain d5hi6b1: 5hi6 B:1-160 [314723]
   Other proteins in same PDB: d5hi6a2, d5hi6b2
   automated match to d3k74a_

Details for d5hi6b1

PDB Entry: 5hi6, 2.05 Å

PDB Description: the high resolution structure of dihydrofolate reductase from yersinia pestis complex with methotrexate as closed form

PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d5hi6b1:

Sequence; same for both SEQRES and ATOM records:

>d5hi6b1 c.71.1.1 (B:1-160) automated matches {Yersinia pestis [TaxId: 214092]}
miisliaalaadrvigmenampwhlpadlawfkrntlnkpvimgrktfesigrplpgrln
ivissqpgtdervtwaasieealafagnaeevmvmgggrvykqfldranrmylthidaev
ggdthfpdyepdewesvfsefhdadeanshsycfeilerr

Timeline for d5hi6b1:

• d5hi6b1 is new in SCOPe 2.06-stable
  
• d5hi6b1 appears in SCOPe 2.07
  
• d5hi6b1 appears in the current release, SCOPe 2.08