Lineage for d5hdja_ (5hdj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963435Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 2963436Protein automated matches [190672] (32 species)
    not a true protein
  7. 2963437Species Bacillus megaterium [TaxId:1404] [314644] (1 PDB entry)
  8. 2963438Domain d5hdja_: 5hdj A: [314722]
    automated match to d1zcha1
    complexed with edo, fmn

Details for d5hdja_

PDB Entry: 5hdj (more details), 1.89 Å

PDB Description: structure of b. megaterium nfra1
PDB Compounds: (A:) NfrA1

SCOPe Domain Sequences for d5hdja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hdja_ d.90.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
nsvietilnhrsirkyedkplseeqiqtivesaqaastssyiqaysiigvkdketkrkla
qlagnqpyvetnghffvfcadfhrhdviaemekkdlstalesteqfmvaiidvalaaqna
tlaaesmglgacyigglrneleevskllklphhviplfgltvghpagitdkkprlpfkhv
yheetyepndeqtkkeltayneeisayynertngkrqdtwtgqmaemlsnpkrmymkefv
ekqgfnk

SCOPe Domain Coordinates for d5hdja_:

Click to download the PDB-style file with coordinates for d5hdja_.
(The format of our PDB-style files is described here.)

Timeline for d5hdja_: