![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [232348] (2 PDB entries) |
![]() | Domain d5hfka2: 5hfk A:86-207 [314721] Other proteins in same PDB: d5hfka1, d5hfkb1 automated match to d3gx0a2 complexed with gsh |
PDB Entry: 5hfk (more details), 1.55 Å
SCOPe Domain Sequences for d5hfka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hfka2 a.45.1.0 (A:86-207) automated matches {Escherichia coli K-12 [TaxId: 83333]} flshetreraatlqwlfwqvgglgpmlgqnhhfnhaapqtipyaieryqvetqrlyhvln krlenspwlggenysiadiacwpwvnawtrqridlamypavknwherirsrpatgqallk aq
Timeline for d5hfka2: