Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (188 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [232346] (2 PDB entries) |
Domain d5hfka1: 5hfk A:1-85 [314720] Other proteins in same PDB: d5hfka2, d5hfkb2 automated match to d3gx0a1 complexed with gsh |
PDB Entry: 5hfk (more details), 1.55 Å
SCOPe Domain Sequences for d5hfka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hfka1 c.47.1.0 (A:1-85) automated matches {Escherichia coli K-12 [TaxId: 83333]} midlyfaptpnghkitlfleeagldyrlikvdlgkggqfrpefllispnnkipaivdhsp adggeplslfesgaillylaektgl
Timeline for d5hfka1: