SCOPe 2.08: Domain d5fhxa_: 5fhx A:

Lineage for d5fhxa_ (5fhx A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Interleukin-4 (IL-4) [47291] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47292] (18 PDB entries)

8. Domain d5fhxa_: 5fhx A: [314703]
   Other proteins in same PDB: d5fhxl1, d5fhxl2, d5fhxl3
   automated match to d2b8ua_
   complexed with po4

Details for d5fhxa_

PDB Entry: 5fhx, 2.55 Å

PDB Description: crystal structure of codv in complex with il4 at 2.55 ang. resolution.

PDB Compounds: (A:) interleukin-4

SCOPe Domain Sequences for d5fhxa_:

Sequence, based on SEQRES records:

>d5fhxa_ a.26.1.2 (A:) Interleukin-4 (IL-4) {Human (Homo sapiens) [TaxId: 9606]}
tlqeiiktlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshhekdtrc
lgataqqfhrhkqlirflkrldrnlwglaglnscpvkeanqstlenflerlktimrekys
kcss

Sequence, based on observed residues (ATOM records):

>d5fhxa_ a.26.1.2 (A:) Interleukin-4 (IL-4) {Human (Homo sapiens) [TaxId: 9606]}
tlqeiiktlnslteqktlcteltvtdifaantteketfcraatvlrqfyshhekdtrclg
ataqqfhrhkqlirflkrldrnlwglaglnscpvkeanqstlenflerlktimrekyskc
ss

Timeline for d5fhxa_:

• d5fhxa_ first appeared in SCOPe 2.06
  
• d5fhxa_ appears in SCOPe 2.07