Lineage for d5hh3c1 (5hh3 C:1-391)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (72 species)
    not a true protein
  7. 2331670Species Actinoplanes teichomyceticus [TaxId:1867] [189592] (6 PDB entries)
  8. 2331674Domain d5hh3c1: 5hh3 C:1-391 [314695]
    Other proteins in same PDB: d5hh3c2
    automated match to d3o1aa_
    complexed with act, gol, hem

Details for d5hh3c1

PDB Entry: 5hh3 (more details), 2.1 Å

PDB Description: oxya from actinoplanes teichomyceticus
PDB Compounds: (C:) OxyA protein

SCOPe Domain Sequences for d5hh3c1:

Sequence, based on SEQRES records: (download)

>d5hh3c1 a.104.1.0 (C:1-391) automated matches {Actinoplanes teichomyceticus [TaxId: 1867]}
mfeeinvvraaelhrrdrfdpvpqlrslmaegplttlgteespggrtawlatgydeirqv
lssddfsarllyggtaagitwpgfltqydppehtrlrrmvapafavrrmqkfqpqvervv
qdsldaiealggpvdfvprfgwsvattatcdflgiprddqadlarslhasrtersgkrrt
aagnkfmtymnkmtartrrdpgddmfgvvvreygdeitdaeltgvaafvmgagadqvarf
laagawlmaddpeqfallrekpdtvpdwldevirylttdekthprvatddvrigdhlika
gdtvtcsllaanrrnfprpedrfditrvrpehlafghgihhclgrslaelvfrtaipala
hrfptlrlaephreirlgpppfdveallldw

Sequence, based on observed residues (ATOM records): (download)

>d5hh3c1 a.104.1.0 (C:1-391) automated matches {Actinoplanes teichomyceticus [TaxId: 1867]}
mfeeinvvraaelhrrdrfdpvpqlrslmaegplttlgteespggrtawlatgydeirqv
lssddfsarllyggtaagifltqydppehtrlrrmvapafavrrmqkfqpqvervvqdsl
daiealggpvdfvprfgwsvattatcdflgiprddqadlarslhasrtersgkrrtaagn
kfmtymnkmtartrrdpgddmfgvvvreygdeitdaeltgvaafvmgagadqvarflaag
awlmaddpeqfallrekpdtvpdwldevirylttdekthprvatddvrigdhlikagdtv
tcsllaanrrnfprpedrfditrvrpehlafghgihhclgrslaelvfrtaipalahrfp
tlrlaephreirlgpppfdveallldw

SCOPe Domain Coordinates for d5hh3c1:

Click to download the PDB-style file with coordinates for d5hh3c1.
(The format of our PDB-style files is described here.)

Timeline for d5hh3c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hh3c2
View in 3D
Domains from other chains:
(mouse over for more information)
d5hh3a_