Lineage for d5hfkb2 (5hfk B:86-205)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2713930Species Escherichia coli [TaxId:83333] [314693] (1 PDB entry)
  8. 2713931Domain d5hfkb2: 5hfk B:86-205 [314694]
    Other proteins in same PDB: d5hfka1, d5hfkb1
    automated match to d3gx0a2
    complexed with gsh

Details for d5hfkb2

PDB Entry: 5hfk (more details), 1.55 Å

PDB Description: crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione
PDB Compounds: (B:) Disulfide-bond oxidoreductase YfcG

SCOPe Domain Sequences for d5hfkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hfkb2 a.45.1.0 (B:86-205) automated matches {Escherichia coli [TaxId: 83333]}
flshetreraatlqwlfwqvgglgpmlgqnhhfnhaapqtipyaieryqvetqrlyhvln
krlenspwlggenysiadiacwpwvnawtrqridlamypavknwherirsrpatgqallk

SCOPe Domain Coordinates for d5hfkb2:

Click to download the PDB-style file with coordinates for d5hfkb2.
(The format of our PDB-style files is described here.)

Timeline for d5hfkb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hfkb1