Lineage for d5hbsa1 (5hbs A:1-134)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2071989Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2071990Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2072541Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2072863Protein automated matches [190295] (6 species)
    not a true protein
  7. 2072879Species Human (Homo sapiens) [TaxId:9606] [187133] (57 PDB entries)
  8. 2072881Domain d5hbsa1: 5hbs A:1-134 [314691]
    Other proteins in same PDB: d5hbsa2
    automated match to d1crba_
    complexed with rtl

Details for d5hbsa1

PDB Entry: 5hbs (more details), 0.89 Å

PDB Description: crystal structure of human cellular retinol binding protein 1 in complex with all-trans-retinol at 0.89 angstrom.
PDB Compounds: (A:) Retinol-binding protein 1

SCOPe Domain Sequences for d5hbsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hbsa1 b.60.1.2 (A:1-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvdftgywkmlvnenfeeylraldvnvalrkianllkpdkeivqdgdhmiirtlstfrny
imdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlemr
vegvvckqvfkkvq

SCOPe Domain Coordinates for d5hbsa1:

Click to download the PDB-style file with coordinates for d5hbsa1.
(The format of our PDB-style files is described here.)

Timeline for d5hbsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hbsa2