![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
![]() | Protein automated matches [190295] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187133] (57 PDB entries) |
![]() | Domain d5hbsa1: 5hbs A:1-134 [314691] Other proteins in same PDB: d5hbsa2 automated match to d1crba_ complexed with rtl |
PDB Entry: 5hbs (more details), 0.89 Å
SCOPe Domain Sequences for d5hbsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hbsa1 b.60.1.2 (A:1-134) automated matches {Human (Homo sapiens) [TaxId: 9606]} pvdftgywkmlvnenfeeylraldvnvalrkianllkpdkeivqdgdhmiirtlstfrny imdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlemr vegvvckqvfkkvq
Timeline for d5hbsa1: