SCOPe 2.08: Domain d5hbsa1: 5hbs A:1-134

Lineage for d5hbsa1 (5hbs A:1-134)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187133] (90 PDB entries)

8. Domain d5hbsa1: 5hbs A:1-134 [314691]
   Other proteins in same PDB: d5hbsa2
   automated match to d1crba_
   complexed with rtl

Details for d5hbsa1

PDB Entry: 5hbs, 0.89 Å

PDB Description: crystal structure of human cellular retinol binding protein 1 in complex with all-trans-retinol at 0.89 angstrom.

PDB Compounds: (A:) Retinol-binding protein 1

SCOPe Domain Sequences for d5hbsa1:

Sequence; same for both SEQRES and ATOM records:

>d5hbsa1 b.60.1.2 (A:1-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvdftgywkmlvnenfeeylraldvnvalrkianllkpdkeivqdgdhmiirtlstfrny
imdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlemr
vegvvckqvfkkvq

Timeline for d5hbsa1:

• d5hbsa1 first appeared in SCOPe 2.06
  
• d5hbsa1 appears in SCOPe 2.07