SCOPe 2.07: Domain d5hd6e1: 5hd6 E:1-172

Lineage for d5hd6e1 (5hd6 E:1-172)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins)
   contains two additional beta-strands in the N-terminal extension

6. Protein automated matches [191220] (4 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [280026] (2 PDB entries)

8. Domain d5hd6e1: 5hd6 E:1-172 [314690]
   Other proteins in same PDB: d5hd6a2, d5hd6b2, d5hd6c2, d5hd6d2, d5hd6e2, d5hd6h2
   automated match to d1mkaa_
   complexed with gol

Details for d5hd6e1

PDB Entry: 5hd6, 1.35 Å

PDB Description: high resolution structure of 3-hydroxydecanoyl-(acyl carrier protein) dehydratase from yersinia pestis at 1.35 a

PDB Compounds: (E:) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase

SCOPe Domain Sequences for d5hd6e1:

Sequence; same for both SEQRES and ATOM records:

>d5hd6e1 d.38.1.2 (E:1-172) automated matches {Yersinia pestis [TaxId: 214092]}
mvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyveaeld
inpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlp
dakkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtnaf

Timeline for d5hd6e1:

• d5hd6e1 first appeared in SCOPe 2.06
  
• d5hd6e1 appears in the current release, SCOPe 2.08