Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (59 species) not a true protein |
Species Francisella tularensis [TaxId:177416] [196438] (3 PDB entries) |
Domain d5hg0b1: 5hg0 B:1-261 [314684] Other proteins in same PDB: d5hg0a2, d5hg0b2 automated match to d3qtta_ complexed with sam |
PDB Entry: 5hg0 (more details), 2.4 Å
SCOPe Domain Sequences for d5hg0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hg0b1 c.26.1.0 (B:1-261) automated matches {Francisella tularensis [TaxId: 177416]} miiadnikqfhsirnslikqqkigfvptmgalhnghislikkaksendvvivsifvnptq fnnpndyqtypnqlqqdiqilasldvdvlfnpsekdiypdgnllriepkleianilegks rpghfsgmltvvlkllqitkpnnlylgekdyqqvmlikqlvkdffintkiivcptqrqps glplssrnknltstdieiankiyeilrqddfsnleeltnkinstgaklqyiqklnnrifl afyigkvrlidnflketgpsc
Timeline for d5hg0b1: