![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.23: ApaG-like [110069] (2 families) ![]() |
![]() | Family b.1.23.0: automated matches [314680] (1 protein) not a true family |
![]() | Protein automated matches [314681] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [314682] (1 PDB entry) |
![]() | Domain d5hdwa1: 5hdw A:278-405 [314683] Other proteins in same PDB: d5hdwa2 automated match to d1xq4b_ |
PDB Entry: 5hdw (more details), 2 Å
SCOPe Domain Sequences for d5hdwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hdwa1 b.1.23.0 (A:278-405) automated matches {Human (Homo sapiens) [TaxId: 9606]} vattgditvsvstsflpelssvhpphyfftyririemskdalpekacqldsrywritnak gdveevqgpgvvgefpiispgrvyeytscttfsttsgymegyytfhflyfkdkifnvaip rfhmacpt
Timeline for d5hdwa1: