Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224896] (72 PDB entries) |
Domain d5hfua2: 5hfu A:223-465 [314670] automated match to d2nzta2 complexed with 603 |
PDB Entry: 5hfu (more details), 2.92 Å
SCOPe Domain Sequences for d5hfua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hfua2 c.55.1.0 (A:223-465) automated matches {Human (Homo sapiens) [TaxId: 9606]} nceiglivgtgsnacymeemrhidmvegdegrmcinmewgafgddgslndirtefdqeid mgslnpgkqlfekmisgmymgelvrlilvkmakeellfggklspellntgrfetkdisdi egekdgirkarevlmrlgldptqedcvathricqivstrsaslcaatlaavlqrikenkg eerlrstigvdgsvykkhphfakrlhktvrrlvpgcdvrflrsedgsgkgaamvtavayr lad
Timeline for d5hfua2:
View in 3D Domains from other chains: (mouse over for more information) d5hfub1, d5hfub2, d5hfub3, d5hfub4 |