Lineage for d1gghc1 (1ggh C:598-753)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) 
conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein) Protein Catalase, C-terminal domain [52329] (2 species) Species Escherichia coli, HPII [TaxId:562] [52330] (17 PDB entries) 
Domain d1gghc1: 1ggh C:598-753 [31467]
Other proteins in same PDB: d1ggha2, d1gghb2, d1gghc2, d1gghd2
complexed with hem
Details for d1gghc1
PDB Entry: 1ggh (more details), 2.15 Å
PDB Description: crystal structure of catalase hpii from escherichia coli, his128ala variant.
PDB Compounds: (C:) catalase hpiiSCOPe Domain Sequences for d1gghc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gghc1 c.23.16.3 (C:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa
SCOPe Domain Coordinates for d1gghc1:
Click to download the PDB-style file with coordinates for d1gghc1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gghc1:
View in 3D
