SCOP 1.57: Domain d1gghc1: 1ggh C:598-753

Lineage for d1gghc1 (1ggh C:598-753)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.23: Flavodoxin-like [52171] (17 superfamilies)

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families)

5. Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein)

6. Protein Catalase, C-terminal domain [52329] (1 species)

7. Species Escherichia coli, HPII [TaxId:562] [52330] (9 PDB entries)

8. Domain d1gghc1: 1ggh C:598-753 [31467]
   Other proteins in same PDB: d1ggha2, d1gghb2, d1gghc2, d1gghd2

Details for d1gghc1

PDB Entry: 1ggh, 2.15 Å

PDB Description: crystal structure of catalase hpii from escherichia coli, his128ala variant.

SCOP Domain Sequences for d1gghc1:

Sequence; same for both SEQRES and ATOM records:

>d1gghc1 c.23.16.3 (C:598-753) Catalase, C-terminal domain {Escherichia coli, HPII}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

Timeline for d1gghc1:

• d1gghc1 first appeared (with stable ids) in SCOP 1.55
  
• d1gghc1 appears in SCOP 1.59
  
• d1gghc1 appears in the current release, SCOPe 2.08