![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) ![]() |
![]() | Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins) contains two additional beta-strands in the N-terminal extension |
![]() | Protein automated matches [191220] (4 species) not a true protein |
![]() | Species Yersinia pestis [TaxId:214092] [280026] (2 PDB entries) |
![]() | Domain d5hd6g_: 5hd6 G: [314663] Other proteins in same PDB: d5hd6a2, d5hd6b2, d5hd6c2, d5hd6d2, d5hd6e2, d5hd6h2 automated match to d1mkaa_ complexed with gol |
PDB Entry: 5hd6 (more details), 1.35 Å
SCOPe Domain Sequences for d5hd6g_:
Sequence, based on SEQRES records: (download)
>d5hd6g_ d.38.1.2 (G:) automated matches {Yersinia pestis [TaxId: 214092]} dkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyveaeldin pdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlpda kkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtnaf
>d5hd6g_ d.38.1.2 (G:) automated matches {Yersinia pestis [TaxId: 214092]} dkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyveaeldin pdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlpda kkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtf
Timeline for d5hd6g_: